CookSnap is coming soon — Join the waitlist →
Back to recipes

Sate Plecing — Spicy Grilled Chicken with Peanut Sauce & Rice Cake

Grilled chicken skewers coated in fiery chili paste, served with creamy peanut sauce and soft lontong. This Indonesian street-food favorite is bold, spicy, and ready in under 30 minutes.

Total time
28 min
Servings
2
Calories
542
Protein
38g
Sate Plecing — Spicy Grilled Chicken with Peanut Sauce & Rice Cake
boldsatisfyingindonesianchickencrispytendercreamyweeknight

Ingredients

  • 4 whole red bird's eye chilies (or Thai red chilies), roughly chopped
  • 3 whole garlic cloves
  • 1 whole shallot, roughly chopped
  • 1 lb boneless, skinless chicken thighs, cut into 1.5-inch pieces
  • ½ cup creamy peanut butter (or natural peanut paste)
  • ¾ cup coconut milk
  • 8 oz lontong (rice cake), halved or sliced

Instructions

  1. 1

    Blend or pound the chilies, garlic, and shallot into a rough paste using a blender or mortar.

  2. 2

    Coat the chicken pieces thoroughly with the chili paste and let sit 5 minutes while you heat oil in a large skillet.

  3. 3

    Cook the chili-coated chicken over medium-high heat, turning occasionally, until edges char and meat is cooked through, ~10 minutes.

  4. 4

    Stir the peanut butter and coconut milk together in a small bowl until smooth, then pour over the cooked chicken.

  5. 5

    Warm the lontong in the skillet alongside the chicken for 2 minutes, stirring gently to coat with sauce.

  6. 6

    Serve the chicken and lontong together, drizzled generously with the peanut sauce from the pan.

Tools you’ll need

  • mortar and pestle or blender
  • 12-inch skillet or wok
  • wooden spoon
  • small mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.