CookSnap is coming soon — Join the waitlist →
Back to recipes

Sara Udon Crispy Noodles with Shrimp

Golden-fried udon noodles topped with plump shrimp in a glossy sweet-savory sauce, finished with scallions and sesame seeds. Restaurant-quality crunch in under 40 minutes.

Total time
35 min
Servings
2
Calories
445
Protein
22g
Sara Udon Crispy Noodles with Shrimp
satisfyingelegantjapaneseshrimpcrispytenderchewyweeknight

Ingredients

  • 7 oz fresh or frozen udon noodles
  • 8 oz medium shrimp, peeled and deveined
  • 3 tablespoons vegetable oil (for frying)
  • 3 tablespoons soy sauce
  • 1.5 tablespoons mirin or honey
  • 1 clove garlic, minced
  • ½ teaspoon ginger, minced
  • 2 stalks scallions, sliced into 2-inch pieces
  • 1 teaspoon sesame seeds (white or black)

Instructions

  1. 1

    If using frozen udon, place the noodles in a strainer and run cold water over them until fully thawed and separated, about 2 minutes, then shake dry.

  2. 2

    Pat the shrimp dry with paper towels by pressing gently on each shrimp to remove surface moisture; dry shrimp will brown better when fried.

  3. 3

    Mince the garlic until the pieces are pencil-tip small, about the size of a grain of rice, then mince the ginger the same way.

  4. 4

    Heat 2 tablespoons of the vegetable oil in a 12-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  5. 5

    Spread the thawed udon noodles in an even layer across the hot oil, pressing gently with a spatula to help them make contact with the pan.

  6. 6

    Let the noodles cook undisturbed for 3 minutes, then flip them in sections with a spatula and cook for another 3 minutes until golden-brown and crispy on both sides.

  7. 7

    Transfer the crispy noodles to a plate and set aside.

  8. 8

    Add the remaining 1 tablespoon of oil to the same skillet over medium-high heat, then add the shrimp in a single layer and cook without moving for 2 minutes until the underside turns pink.

  9. 9

    Flip each shrimp with tongs and cook for another 1 minute until the other side is also pink; transfer to a small bowl.

  10. 10

    Pour the soy sauce and mirin into the same skillet over medium heat, then add the minced garlic and ginger and stir constantly for 30 seconds until fragrant.

  11. 11

    Return the cooked shrimp to the skillet and stir gently for 20 seconds to coat with the sauce.

  12. 12

    Divide the crispy noodles between two plates, mounding them in the center of each plate.

  13. 13

    Top each nest of noodles with the shrimp and sauce, spooning the liquid evenly over both servings.

  14. 14

    Scatter the sliced scallions over the noodles and shrimp, then sprinkle 0.5 teaspoon of sesame seeds over each plate.

Tools you’ll need

  • 12-inch skillet
  • fine-mesh strainer
  • paper towels
  • cutting board and knife
  • spatula
  • tongs
  • small bowl
  • two serving plates

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.