Custrd is out on the App Store — Download it free →
Back to recipes

Roast Chicken with Mashed Potatoes and Vegetables

A quick and comforting plate of juicy roast chicken, creamy mashed potatoes, and tender green vegetables. Perfect for a busy weeknight dinner.

Total time
25 min
Servings
2
Calories
550
Protein
45g
Roast Chicken with Mashed Potatoes and Vegetables
comfortingAmericangluten-freechickencreamytenderweeknightmain course

Ingredients

  • 2 whole chicken breast
  • 4 medium potatoes
  • 2 cups green beans
  • 2 tablespoons butter
  • ¼ cup milk
  • 1 tablespoon olive oil

Instructions

  1. 1

    Preheat oven to 400°F. Rub the 2 chicken breasts with 1 tbsp olive oil and season with salt and pepper. Place on a baking sheet and roast until cooked through, about 20 minutes.

  2. 2

    While chicken roasts, peel and quarter the 4 potatoes. Boil in salted water until fork-tender, about 15 minutes. Drain and return to pot.

  3. 3

    Add 2 tbsp butter and 1/4 cup milk to the potatoes. Mash until smooth and creamy. Season with salt and pepper.

  4. 4

    Steam the 2 cups green beans until bright green and crisp-tender, about 5 minutes. Season with a pinch of salt.

  5. 5

    Serve the chicken alongside the mashed potatoes and green beans.

Tools you’ll need

  • baking sheet
  • pot
  • masher
  • steamer basket

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.