Ricotta Toast with Honey
Creamy ricotta spread on warm toast, drizzled with golden honey and a pinch of sea salt. Ready in under 5 minutes—the perfect snack or light breakfast.
- Total time
- 5 min
- Servings
- 2
- Calories
- 245
- Protein
- 9g
simplefreshvegetariancheesecreamycrispyweeknighttoast
Ingredients
- 2 slices bread (sourdough, ciabatta, or whole grain)
- ½ cup whole milk ricotta
- 2 tablespoons honey
- ⅛ teaspoon sea salt
Instructions
- 1
Toast bread until golden and crisp, ~2–3 minutes per side.
- 2
Divide ricotta evenly between the two slices, spreading gently with a knife.
- 3
Drizzle honey over each toast in a thin zigzag, then sprinkle with sea salt.
- 4
Serve immediately while the toast is still warm.
Tools you’ll need
- toaster or toaster oven
- knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
