CookSnap is coming soon — Join the waitlist →

Raspberry Macarons

Delicate French almond meringue cookies with a crispy shell and chewy center, filled with tangy raspberry buttercream. A stunning homemade treat that looks professional but requires patience and precision.

Total time
75 min
Servings
12
Calories
142
Protein
2g
Raspberry Macarons
elegantfancyfrenchvegetariancrispychewysmoothdate-night

Ingredients

  • 3.5 large egg whites (room temperature), divided
  • 100 g almond flour, blanched
  • 100 g powdered sugar
  • 50 g granulated sugar
  • 100 g butter, softened
  • 150 g powdered sugar
  • 75 g raspberry jam or puree

Instructions

  1. 1

    Preheat oven to 300°F. Line two sheet pans with parchment paper.

  2. 2

    Sift almond flour and powdered sugar together 3 times into a bowl to remove lumps.

  3. 3

    Whip 3 egg whites in a clean bowl until soft peaks form, ~2 minutes.

  4. 4

    Gradually add granulated sugar while whipping until stiff, glossy peaks form, ~2 minutes.

  5. 5

    Fold almond-sugar mixture into meringue in three parts until batter is smooth and flows like lava.

  6. 6

    Transfer batter to piping bag. Pipe 1.5-inch rounds onto parchment, 1 inch apart.

  7. 7

    Tap sheet pan firmly on counter 5 times to release air bubbles. Let sit 30 minutes.

  8. 8

    Bake 15 minutes until shells are dry and feet are visible. Shells should not stick when lifted.

  9. 9

    Cool on pans 10 minutes, then transfer to wire rack to cool completely, ~30 minutes.

  10. 10

    Whip softened butter with powdered sugar until pale and fluffy, ~3 minutes.

  11. 11

    Fold in raspberry jam gently until just combined; do not overmix.

  12. 12

    Pipe filling onto flat side of one shell, then sandwich with another shell.

  13. 13

    Chill filled macarons 30 minutes before serving. Store in airtight container up to 5 days.

Tools you’ll need

  • two 13x9 inch sheet pans
  • parchment paper
  • fine-mesh sieve
  • electric mixer with whisk
  • large bowl
  • rubber spatula
  • piping bag with 0.5-inch round tip
  • wire rack

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.