CookSnap is coming soon — Join the waitlist →
Back to recipes

Rainbow Sushi Bowl with Quick Miso Soup

A vibrant deconstructed sushi bowl loaded with sushi rice, crisp vegetables, creamy avocado, and a tangy ginger-soy drizzle—plus a quick miso soup on the side. Ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
380
Protein
8g
Rainbow Sushi Bowl with Quick Miso Soup
freshlightcalifornianvegetarianvegetariancrispycreamyweeknight

Ingredients

  • 2 cups sushi rice (cooked)
  • 1 whole cucumber
  • 1 whole avocado
  • ¾ cup shredded carrot
  • 2 sheets nori sheets
  • 1 tbsp fresh ginger (grated)
  • 2 tbsp miso paste

Instructions

  1. 1

    Heat 2 cups water in a saucepan over medium heat until steaming, about 4 minutes.

  2. 2

    Stir in miso paste until dissolved, then divide between two bowls. Serve hot as miso soup.

  3. 3

    Divide cooked sushi rice between two bowls, pressing gently to create a bed.

  4. 4

    Slice cucumber into thin rounds and cut avocado into thin wedges. Tear nori into bite-sized pieces.

  5. 5

    Arrange cucumber, avocado, shredded carrot, and nori pieces in separate piles on top of each rice bowl.

  6. 6

    Whisk together 2 tbsp soy sauce, grated ginger, and 1 tbsp rice vinegar. Drizzle over the bowl and serve with the miso soup.

Tools you’ll need

  • saucepan
  • two bowls
  • knife and cutting board
  • whisk or fork

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.