CookSnap is coming soon — Join the waitlist →
Back to recipes

Quick Argentine Veggie Tart with Creamy Sauce

Buttery puff pastry layered with sautéed zucchini, bell pepper, and onion, finished with a garlicky sour cream sauce. Ready in 20 minutes — no rolling required.

Total time
20 min
Servings
2
Calories
385
Protein
6g
Quick Argentine Veggie Tart with Creamy Sauce
simplecasualargentinianvegetarianvegetarianflakytendercreamy

Ingredients

  • 2 sheets puff pastry sheets (thawed if frozen)
  • 1 medium zucchini, sliced into thin half-moons
  • 1 medium red bell pepper, diced
  • ½ medium yellow onion, thinly sliced
  • ¾ cup sour cream
  • 2 cloves garlic, minced

Instructions

  1. 1

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. 2

    Add onion, zucchini, and bell pepper. Sauté, stirring often, until vegetables soften and edges curl, 6–7 minutes.

  3. 3

    Stir in minced garlic and cook 30 seconds until fragrant, then remove from heat.

  4. 4

    Toast puff pastry sheets in a dry skillet or toaster oven (or microwave 45 seconds) until just warm and pliable.

  5. 5

    Divide sautéed vegetables between the two pastry sheets, spreading them evenly across the surface.

  6. 6

    Stir sour cream with a pinch of salt and pepper, then drizzle over top. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • toaster oven or microwave

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.