Custrd is out on the App Store — Download it free →
Back to recipes

Quick Argentine Veggie Tart with Creamy Sauce

Buttery puff pastry layered with sautéed zucchini, bell pepper, and onion, finished with a garlicky sour cream sauce. Ready in 20 minutes — no rolling required.

Total time
20 min
Servings
2
Calories
385
Protein
6g
Quick Argentine Veggie Tart with Creamy Sauce
simplecasualargentinianvegetarianvegetarianflakytendercreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. Step 2

    Add onion, zucchini, and bell pepper. Sauté, stirring often, until vegetables soften and edges curl, 6–7 minutes.

  3. Step 3

    Stir in minced garlic and cook 30 seconds until fragrant, then remove from heat.

  4. Step 4

    Toast puff pastry sheets in a dry skillet or toaster oven (or microwave 45 seconds) until just warm and pliable.

  5. Step 5

    Divide sautéed vegetables between the two pastry sheets, spreading them evenly across the surface.

  6. Step 6

    Stir sour cream with a pinch of salt and pepper, then drizzle over top. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • toaster oven or microwave

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.