CookSnap is coming soon — Join the waitlist →
Back to recipes

Quiche aux Épinards

A classic French spinach quiche with a buttery crust, creamy custard, and earthy wilted spinach. Elegant enough for dinner, simple enough for any home cook.

Total time
50 min
Servings
4
Calories
485
Protein
16g
Quiche aux Épinards
elegantcomfortablefrenchvegetarianeggscheesecreamyflaky

Ingredients

  • 1.25 cups all-purpose flour
  • 6 tbsp butter, cold, cubed
  • 3 tbsp ice water
  • 10 oz fresh spinach
  • 4 large eggs
  • ¾ cup heavy cream
  • 1 cup gruyère cheese, shredded
  • 1 medium shallot, minced
  • ¼ tsp nutmeg, ground

Instructions

  1. 1

    Mix flour and 0.5 tsp salt in a bowl. Add cold butter and rub with your fingers until mixture looks like breadcrumbs.

  2. 2

    Add ice water 1 tbsp at a time, tossing gently, until dough just holds together when squeezed.

  3. 3

    Form dough into a flat disk, wrap in plastic, and refrigerate for 15 minutes.

  4. 4

    Roll dough to 1/8-inch thick on a floured surface. Transfer to a 9-inch pie dish and trim edges.

  5. 5

    Prick bottom with a fork. Line with parchment and fill with dried beans or weights.

  6. 6

    Bake at 375°F for 12 minutes until pale. Remove parchment and weights.

  7. 7

    Heat 1 tbsp butter in a large skillet over medium. Sauté shallot until soft, about 2 minutes.

  8. 8

    Add spinach in batches and stir until wilted and any liquid evaporates, 3–4 minutes total.

  9. 9

    Whisk eggs and cream in a bowl with nutmeg, 0.5 tsp salt, and black pepper to taste.

  10. 10

    Stir spinach and shallot into egg mixture. Fold in gruyère.

  11. 11

    Pour custard into the par-baked crust. Smooth the surface.

  12. 12

    Bake at 375°F for 25–30 minutes until the center is set but still jiggles slightly when shaken.

  13. 13

    Let rest for 5 minutes before slicing. Serve warm or at room temperature.

Tools you’ll need

  • mixing bowl
  • 9-inch pie dish
  • rolling pin
  • fork
  • parchment paper
  • dried beans or pie weights
  • large skillet
  • wooden spoon
  • whisk
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.