CookSnap is coming soon — Join the waitlist →

Puchka (Crispy Potato Pani Puri)

Hollow crispy shells filled with spiced potatoes, chickpeas, and tangy tamarind water. A beloved Indian street snack that's crunchy, refreshing, and bursting with flavor in every bite.

Total time
25 min
Servings
2
Calories
185
Protein
6g
Puchka (Crispy Potato Pani Puri)
casualfreshindianvegetarianchickpeascrispycrunchysnack

Ingredients

  • 2 medium (about 1 cup) boiled potatoes, peeled
  • ¾ cup canned chickpeas, drained
  • 3 tablespoons tamarind paste
  • 1 cup water
  • ½ teaspoon cumin powder
  • ¼ teaspoon cayenne pepper
  • 12 shells crispy puri shells (store-bought)

Instructions

  1. 1

    Cut each boiled potato into 1/4-inch cubes—small enough to fit inside a puri shell. Place the cubes in a small bowl.

  2. 2

    Pour the tamarind paste into a measuring cup and add 1 cup of water; stir until the paste is completely dissolved and the liquid is dark brown and thin, about 30 seconds.

  3. 3

    Add the cumin powder, cayenne pepper, and chickpeas to the potato cubes; stir gently until everything is evenly coated.

  4. 4

    Hold one puri shell carefully in your hand and gently poke a hole in the top with your thumb, making an opening about the size of a fingertip.

  5. 5

    Spoon 1 heaping teaspoon of the potato-chickpea mixture into the opening of the puri shell, filling it so the mixture is just visible at the top.

  6. 6

    Set the filled puri on a serving plate, opening facing upward; repeat with remaining shells and filling until you have 12 filled puris.

  7. 7

    Place a small cup or bowl of tamarind water on the plate next to the puris; diners will pop each puri in their mouth, bite off the bottom, and sip the tamarind water through the hole.

Tools you’ll need

  • cutting board
  • paring knife
  • 2 small bowls
  • measuring cup
  • measuring spoons
  • spoon for stirring
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.