Polish Cucumber Soup (Ogórkowa)
A tangy, warming Polish classic made with fresh dill, sour cream, and tender diced cucumbers. Ready in 25 minutes—pure comfort in a bowl.
- Total time
- 25 min
- Servings
- 4
- Calories
- 215
- Protein
- 5g
comfortlightpolishvegetarianvegetariancreamytenderweeknight
Ingredients
- 2 tbsp butter
- 1 medium onion, diced
- 2 medium potatoes, diced small
- 4 cups vegetable broth
- 3 medium cucumbers, peeled and diced
- ¾ cup sour cream
- 3 tbsp fresh dill, chopped (plus more for serving)
Instructions
- 1
Melt butter in a large pot over medium heat, ~1 minute.
- 2
Add diced onion and sauté until translucent, stirring occasionally, 4 minutes.
- 3
Pour in broth and add potatoes. Bring to a boil, then reduce heat and simmer.
- 4
Add diced cucumbers and simmer until potatoes and cucumbers are tender, 8 minutes.
- 5
Remove from heat. Stir in sour cream and fresh dill until smooth and combined.
- 6
Season with salt and pepper to taste. Serve hot, garnished with more dill.
Tools you’ll need
- large pot (4-quart minimum)
- cutting board
- chef's knife
- wooden spoon
- measuring cups and spoons
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
