CookSnap is coming soon — Join the waitlist →
Back to recipes

Poached Eggs in Spicy Tomato Sauce

Israeli shakshuka-style poached eggs nestled in a vibrant, gently spiced tomato sauce. A showstopping breakfast that's ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
380
Protein
14g
Poached Eggs in Spicy Tomato Sauce
Israelibreakfastisraelieggvegetarianspicyone-pangluten-free

Ingredients

  • 3 tbsp olive oil
  • 1 medium onion
  • 3 clove garlic cloves
  • ½ large red bell pepper
  • 14 oz canned crushed tomatoes
  • 2 tbsp tomato paste
  • 1 tsp cumin
  • 1 tsp paprika
  • ¼ tsp cayenne pepper
  • ½ tsp sea salt
  • ¼ tsp black pepper
  • 4 large eggs
  • ¼ cup fresh cilantro
  • 2 tbsp fresh parsley

Instructions

  1. 1

    Heat 3 tbsp olive oil in a large skillet over medium heat. Dice the onion into small pieces and add to the pan, stirring occasionally, until softened and translucent, about 5 minutes.

  2. 2

    Mince the 3 garlic cloves and dice the red bell pepper. Add both to the skillet and cook over medium heat, stirring frequently, until fragrant and the pepper begins to soften, about 2-3 minutes.

  3. 3

    Stir in the 2 tbsp tomato paste, 1 tsp cumin, 1 tsp paprika, and 0.25 tsp cayenne pepper. Toast the spices for about 1 minute, stirring constantly, until they darken slightly and become fragrant.

  4. 4

    Pour in the 14 oz canned crushed tomatoes and stir well to combine all ingredients. Bring the sauce to a gentle simmer over medium-high heat, then reduce heat to medium-low. Season with 0.5 tsp sea salt and 0.25 tsp black pepper. Simmer uncovered for 8-10 minutes, stirring occasionally, until the sauce thickens slightly and flavors meld.

  5. 5

    Make 4 small wells or indentations in the simmering sauce using the back of a spoon. Carefully crack each egg into a well, spacing them evenly around the pan. The sauce should surround but not fully cover the eggs.

  6. 6

    Cover the skillet with a lid or large plate and poach over medium-low heat for 4-6 minutes. The eggs are done when the whites are set and opaque but the yolks still jiggle slightly when gently shaken. For firmer yolks, cook 1-2 minutes longer.

  7. 7

    Remove from heat and sprinkle the 0.25 cup fresh cilantro and 2 tbsp fresh parsley over the top. Serve the skillet family-style, with crusty bread for dipping into the sauce and scooping up each poached egg.

Tools you’ll need

  • Large skillet (10-12 inch)
  • Lid or large plate
  • Wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.