CookSnap is coming soon — Join the waitlist →
Back to recipes

Placki Ziemniaczane (Polish Potato Pancakes)

Crispy golden potato pancakes are a Polish classic—shredded potato and onion bound with egg and flour, pan-fried until the edges are lacy and brown. Serve with sour cream or applesauce for an easy weeknight dinner or side.

Total time
35 min
Servings
4
Calories
285
Protein
5g
Placki Ziemniaczane (Polish Potato Pancakes)
comfortcasualpolishvegetarianvegetariancrispytenderweeknight

Ingredients

  • 1.5 lb russet potatoes
  • ½ medium yellow onion
  • 1 large egg
  • 3 tbsp all-purpose flour
  • ¾ tsp salt
  • ¼ tsp black pepper
  • ½ cup vegetable oil

Instructions

  1. 1

    Peel potatoes and onion. Using a box grater, shred potatoes and onion into a colander.

  2. 2

    Press shredded mixture with a clean kitchen towel to remove as much liquid as possible.

  3. 3

    Transfer to a bowl. Add egg, flour, salt, and black pepper. Stir until just combined.

  4. 4

    Heat oil in a 12-inch skillet over medium-high until shimmering, about 1 minute.

  5. 5

    Working in batches, drop 2-tbsp portions of batter into hot oil, flattening gently with a spatula into 3-inch pancakes.

  6. 6

    Fry 3–4 minutes per side until edges look lacy and browned. Transfer to a paper-towel-lined plate.

  7. 7

    Repeat with remaining batter, adding more oil if needed to maintain shimmer.

  8. 8

    Serve hot with sour cream, applesauce, or both on the side.

Tools you’ll need

  • box grater
  • colander
  • clean kitchen towel
  • large bowl
  • 12-inch cast iron or stainless steel skillet
  • slotted spatula
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.