5-Min Pizza Toast Bites
Crispy bread topped with melted cheese and tomato, broiled until bubbling. Serve with ketchup and mayo for dipping—it's pizza night meets snack time.
- Total time
- 5 min
- Servings
- 2
- Calories
- 285
- Protein
- 12g
casualquickitalianvegetariancheesecrispymeltysnack
Ingredients
- 4 slices bread slices (white, sourdough, or Italian)
- ¾ cup shredded mozzarella or pizza cheese blend
- ¼ cup marinara or tomato sauce
- 2 tbsp each ketchup and mayonnaise, for serving
Instructions
- 1
Arrange bread slices on a sheet pan and slide under the broiler for 90 seconds until lightly toasted.
- 2
Spread 1 tbsp marinara sauce on each toasted slice, then top with 3 tbsp cheese.
- 3
Broil for 2–3 minutes until cheese melts and edges bubble—watch closely.
- 4
Transfer to a plate and serve hot with ketchup and mayo on the side for dipping.
Tools you’ll need
- sheet pan
- broiler
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
