CookSnap is coming soon — Join the waitlist →

Pizza Frutti di Mare

A classic Italian seafood pizza with shrimp, mussels, and clams on a crispy crust, finished with fresh garlic, white wine, and parsley. Ready in under 30 minutes using store-bought dough.

Total time
25 min
Servings
2
Calories
520
Protein
28g
Pizza Frutti di Mare
elegantfreshitalianshrimpfishcrispytenderchewy

Ingredients

  • 1 pound store-bought pizza dough (thawed if frozen)
  • ½ pound shrimp, peeled and deveined
  • ¾ pound mussels or littleneck clams, scrubbed clean
  • 3 cloves garlic, minced
  • ¼ cup dry white wine
  • 3 tablespoons fresh parsley, chopped

Instructions

  1. 1

    Set the oven to 500°F and wait for the indicator light or beep, about 10 minutes, so the oven reaches full heat.

  2. 2

    Pat the shrimp dry with paper towels by placing each one on the towel and gently pressing until moisture is gone.

  3. 3

    Stretch the pizza dough by pulling it gently with both hands until it covers the bottom of a 14-inch round pizza pan or a rectangular sheet pan.

  4. 4

    Brush the dough generously with olive oil on all surfaces, then sprinkle salt and pepper evenly across the top and edges.

  5. 5

    Bake the crust in the preheated 500°F oven for 8 minutes, until the edges are pale gold and the surface looks slightly puffed.

  6. 6

    Remove the pan from the oven, scatter the minced garlic over the crust, then arrange the shrimp and mussels in a single layer across the surface.

  7. 7

    Pour the white wine evenly over the shellfish so it pools slightly on the crust, distributing it across the entire pizza.

  8. 8

    Return the pizza to the 500°F oven and bake for 7 minutes, until the shrimp turn opaque pink and the mussels open (discard any that don't open).

  9. 9

    Remove the pizza from the oven and scatter the fresh parsley over the top in a light, even layer.

  10. 10

    Slice the pizza into wedges and serve immediately while the crust is crispy and the seafood is still hot.

Tools you’ll need

  • 14-inch round pizza pan or rectangular sheet pan
  • oven
  • pastry brush
  • paper towels
  • cutting board
  • chef's knife
  • kitchen shears (for mussels, optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.