CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Pistachio Pesto Casarecce

Creamy, nutty pistachio pesto coats tender casarecce pasta in under 20 minutes. A bright, simple Italian dinner that tastes way more impressive than it is.

Total time
18 min
Servings
2
Calories
680
Protein
22g
Pistachio Pesto Casarecce
simpleelegantitalianvegetarianvegetariancreamytenderweeknight

Ingredients

  • 8 oz casarecce pasta
  • ¾ cup shelled roasted pistachios
  • ½ cup parmesan, grated
  • 1 cup fresh basil leaves
  • 1 whole (zested + juiced) lemon
  • 1 cup (halved) cherry tomatoes

Instructions

  1. 1

    Boil casarecce in salted water until al dente, ~11 minutes. Reserve 0.5 cup pasta water, then drain.

  2. 2

    Pulse pistachios, basil, parmesan, lemon zest, 1 tbsp lemon juice, and 3 tbsp olive oil until chunky.

  3. 3

    Toss hot pasta with pesto, adding reserved pasta water 1 tbsp at a time until sauce coats noodles.

  4. 4

    Fold in halved cherry tomatoes gently. Taste and adjust salt, pepper, and lemon juice as needed.

  5. 5

    Serve immediately, drizzling with more olive oil and a pinch of fleur de sel if you have it.

Tools you’ll need

  • large pot
  • food processor or blender
  • large mixing bowl
  • measuring cups and spoons
  • box grater or microplane
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.