10-Min Pineapple Fried Rice with Tomatoes
Crispy jasmine rice tossed with sweet pineapple, tomatoes, and a salty-savory sauce. Ready in one pan and totally vegan.
- Total time
- 10 min
- Servings
- 2
- Calories
- 385
- Protein
- 6g
freshquickthaiveganvegetariancrispytenderweeknight
Ingredients
- 3 cups cooked jasmine rice, chilled
- 1.5 cups fresh pineapple, cut into 0.5-inch chunks
- 1 medium tomato, sliced into wedges
- 2 tbsp soy sauce
- 2 tbsp neutral cooking oil
- 2 cloves garlic, minced
Instructions
- 1
Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.
- 2
Add garlic and cook for 30 seconds until fragrant, stirring constantly.
- 3
Add rice, breaking up any clumps, and stir-fry for 3 minutes until edges start to crisp.
- 4
Add pineapple chunks and soy sauce, toss for 2 minutes until pineapple softens slightly.
- 5
Divide rice into two bowls and top each with sliced tomato wedges.
- 6
Serve immediately while the rice is still warm and crispy.
Tools you’ll need
- large skillet (12-inch)
- wooden spoon or spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
