Pho Quick
A streamlined Vietnamese soup ready in 20 minutes using store-bought broth and quick-cooking noodles. Fresh herbs and lime brighten the bowls.
- Total time
- 20 min
- Servings
- 4
- Calories
- 180
- Protein
- 3g
freshlightvietnamesetendersilkyweeknightsoupdinner
Ingredients
- 6 cups beef or vegetable broth
- 8 oz fresh rice noodles
- 2 whole star anise
- 1 whole cinnamon stick
- 1 tbsp ginger, sliced
- 1.5 tbsp fish sauce
- 1 lime + handful herbs lime (juice) and fresh herbs (basil, cilantro, mint), chopped
Instructions
- 1
Bring broth to a boil in a large pot over high heat, ~5 minutes.
- 2
Add star anise, cinnamon, and ginger slices. Simmer 3 minutes until fragrant.
- 3
Stir in fish sauce and taste—adjust salt and fish sauce as needed.
- 4
Add rice noodles and cook until tender, ~2 minutes (check package time).
- 5
Divide noodles and broth among four bowls, discarding whole spices if desired.
- 6
Squeeze fresh lime juice over each bowl and top with basil, cilantro, and mint.
Tools you’ll need
- large pot (4-quart or larger)
- wooden spoon
- ladle
- bowl (four serving bowls)
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
