CookSnap is coming soon — Join the waitlist →
Back to recipes

Pho Hai San (Seafood Pho)

A bright, aromatic Vietnamese seafood soup with shrimp, squid, and fish in a fragrant star anise and ginger broth, ready in under 45 minutes. Serve with fresh herbs and lime for a complete, restaurant-quality bowl.

Total time
40 min
Servings
2
Calories
320
Protein
38g
Pho Hai San (Seafood Pho)
freshwholesomevietnameseshrimpfishtendersilkyweeknight

Ingredients

  • 3 whole dried star anise pods
  • 2 inch piece fresh ginger, unpeeled
  • 2 tablespoons fish sauce
  • 6 cups chicken or seafood broth
  • 4 ounces dried rice noodles (1/8-inch wide)
  • 6 ounces large shrimp, peeled and deveined
  • 6 ounces firm white fish (cod or halibut), cut into bite-sized pieces
  • 4 ounces squid, cleaned and sliced into 1/4-inch rings
  • 1 bundle fresh herbs (Thai basil, cilantro, mint) and lime wedges for serving

Instructions

  1. 1

    Place the ginger piece on a cutting board, then use the flat side of a large knife to press down and crush it until you hear it crack and see it flatten — do not cut it.

  2. 2

    Bring a large pot of water to a boil over high heat, then add the rice noodles and stir once to separate them — cook until softened and chewy, about 5 minutes.

  3. 3

    Drain the noodles in a colander, divide them between two deep bowls, and set the bowls on the counter near your stove.

  4. 4

    Pour the broth into a medium pot and place it over medium-high heat, then add the crushed ginger and star anise pods — bring to a rolling boil, about 5 minutes.

  5. 5

    Add the fish sauce and stir once, then reduce heat to medium and let it simmer gently for 10 minutes so the flavors infuse — the surface should bubble slowly, not rapidly.

  6. 6

    Taste a tiny spoonful of broth — it should smell strongly of anise and taste savory and slightly salty; if too salty, add 1/4 cup water and taste again.

  7. 7

    Add the shrimp and fish pieces to the simmering broth, stirring gently once to separate them — cook until the shrimp turns pink and the fish looks opaque, about 3 minutes.

  8. 8

    Add the squid rings and stir once, cooking for 1 more minute until the rings curl tightly and look opaque white — do not overcook or they will become rubbery.

  9. 9

    Remove the ginger and star anise pods from the broth using a slotted spoon or small strainer and discard them.

  10. 10

    Ladle the hot broth with shrimp, fish, and squid evenly over the noodles in each bowl, then top with a small handful of fresh herbs and serve with lime wedges on the side.

Tools you’ll need

  • large chef's knife
  • large pot with lid
  • medium pot with lid
  • colander
  • two deep bowls
  • slotted spoon or small strainer
  • ladle
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.