CookSnap is coming soon — Join the waitlist →
Back to recipes

Peruvian Chicken & Potato Soup

Creamy yet broth-based, this classic Peruvian comfort soup balances tender chicken, potatoes, and corn with turmeric, cumin, and a silky finish of evaporated milk and egg yolk. Served with lime wedges and fresh cilantro.

Total time
50 min
Servings
6
Calories
298
Protein
32g
Peruvian Chicken & Potato Soup
comfortwholesomeperuvianchickencreamytendersilkyweeknight

Ingredients

  • 1.5 lb boneless, skinless chicken breasts
  • 1 large yellow onion
  • 4 cloves garlic cloves
  • 1.5 lb Yukon gold potatoes
  • 1 cup fresh corn kernels (or frozen)
  • 8 cups chicken broth
  • ½ cup evaporated milk
  • 1 large egg yolk
  • 1 tsp ground cumin
  • ½ tsp ground turmeric
  • ⅓ cup fresh cilantro (chopped) plus lime wedges for serving
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Slice onion into 1/2-inch-thick wedges. Mince garlic. Peel potatoes and cut into 1-inch cubes.

  2. 2

    Pour broth into a large pot and bring to a boil over medium-high heat, ~5 minutes.

  3. 3

    Add chicken, onion, garlic, cumin, and turmeric. Return to a simmer.

  4. 4

    Simmer 15 minutes, then add potatoes. Continue simmering 10 minutes until potatoes are almost tender.

  5. 5

    Stir in corn and simmer 3 more minutes until potatoes are fully tender and corn is heated.

  6. 6

    Remove from heat. Lift chicken onto a cutting board and shred into bite-sized pieces.

  7. 7

    Whisk egg yolk with evaporated milk in a small bowl until combined.

  8. 8

    Slowly pour egg mixture into the pot while stirring gently. Do not boil or the egg will curdle.

  9. 9

    Return shredded chicken to the pot and stir. Season with salt and pepper to taste.

  10. 10

    Ladle soup into bowls. Top with fresh cilantro and serve with lime wedges on the side.

Tools you’ll need

  • large pot (6+ quart capacity)
  • cutting board
  • chef's knife
  • small bowl
  • whisk
  • wooden spoon
  • ladle
  • tongs or fork

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.