Perfect Cappuccino
Espresso topped with velvety steamed milk and a whisper of foam—the classic Italian way. Takes 5 minutes, tastes like a café.
- Total time
- 5 min
- Servings
- 1
- Calories
- 85
- Protein
- 4g
cozysimpleitalianvegetariancreamysilkybreakfastsnack
Ingredients
- ½ cup whole milk, cold
- 1.5 oz espresso shots (or strong brewed coffee)
- ¼ tsp unsweetened cocoa powder (optional garnish)
Instructions
- 1
Pull 1.5 oz espresso into a cup or use 2–3 tbsp strong brewed coffee.
- 2
Pour cold milk into a metal pitcher. Steam until the pitcher is too hot to touch and you hear a steady whisper sound, about 90 seconds.
- 3
Gently pour steamed milk into the espresso, holding back foam with a spoon. Fill the cup two-thirds with milk and top with 0.5 inch of foam.
- 4
Dust lightly with cocoa powder if desired. Serve immediately.
Tools you’ll need
- espresso machine with steam wand (or French press for brewed coffee)
- 8 oz ceramic cup or glass
- 12 oz stainless steel milk pitcher
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
