CookSnap is coming soon — Join the waitlist →
Back to recipes

5-Min Pepperoni French Bread Pizza

Slice a baguette lengthwise, top with pizza sauce, mozzarella, and pepperoni, then broil until the cheese melts and bubbles. Crispy crust, melty cheese, salty pepperoni — ready in under 5 minutes.

Total time
5 min
Servings
2
Calories
680
Protein
28g
5-Min Pepperoni French Bread Pizza
quickcasualamericanporkcrispymeltyweeknightsandwich

Ingredients

  • 1 loaf french bread (baguette)
  • ½ cup pizza sauce
  • 1.5 cups mozzarella cheese, shredded
  • 1 cup pepperoni slices

Instructions

  1. 1

    Heat your broiler to high and line a baking sheet with foil.

  2. 2

    Slice the baguette in half lengthwise and place cut-side up on the sheet.

  3. 3

    Spread pizza sauce evenly over both halves, leaving a 1/2-inch border.

  4. 4

    Layer pepperoni slices over the sauce, then top with shredded mozzarella.

  5. 5

    Broil 2–3 minutes until cheese is melted and bubbling, edges just starting to brown.

  6. 6

    Remove from broiler and let cool 1 minute before slicing and serving.

Tools you’ll need

  • broiler oven
  • baking sheet
  • aluminum foil
  • serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.