Peanut Butter Oatmeal Bars
No-bake peanut butter and oat bars that come together in minutes. Chewy, satisfying, and perfect for grabbing on the go.
- Total time
- 10 min
- Servings
- 8
- Calories
- 312
- Protein
- 9g

quicksatisfyingvegetarianchewycrumblycookiesnackno-cook
Ingredients
- 1 cup creamy peanut butter
- 1.5 cups rolled oats
- ½ cup honey
- 4 tbsp butter
- ¼ tsp salt
Instructions
- 1
Line an 8×8-inch baking pan with parchment paper, leaving overhang on two sides.
- 2
Combine peanut butter, honey, and butter in a medium bowl and stir until smooth.
- 3
Fold in oats and salt until no dry spots remain and the mixture looks compact.
- 4
Press the mixture firmly into the pan, using a spatula to pack it down evenly.
- 5
Refrigerate for 5 minutes, then lift out using the parchment overhang and cut into 8 bars.
Tools you’ll need
- 8×8-inch baking pan
- parchment paper
- medium bowl
- spoon or spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



