CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Peanut Butter Oatmeal Bars

No-bake peanut butter and oat bars that come together in minutes. Chewy, satisfying, and perfect for grabbing on the go.

Total time
10 min
Servings
8
Calories
312
Protein
9g
Peanut Butter Oatmeal Bars
quicksatisfyingvegetarianchewycrumblyBreakfastcookiesnack

Ingredients

  • 1 cup creamy peanut butter
  • 1.5 cups rolled oats
  • ½ cup honey
  • 4 tbsp butter
  • ¼ tsp salt

Instructions

  1. 1

    Line an 8×8-inch baking pan with parchment paper, leaving overhang on two sides.

  2. 2

    Combine peanut butter, honey, and butter in a medium bowl and stir until smooth.

  3. 3

    Fold in oats and salt until no dry spots remain and the mixture looks compact.

  4. 4

    Press the mixture firmly into the pan, using a spatula to pack it down evenly.

  5. 5

    Refrigerate for 5 minutes, then lift out using the parchment overhang and cut into 8 bars.

Tools you’ll need

  • 8×8-inch baking pan
  • parchment paper
  • medium bowl
  • spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.