CookSnap is coming soon — Join the waitlist →
Back to recipes

Pasteli (Sesame Brittle)

A crispy, golden Greek sesame brittle made with just honey, sesame seeds, and a pinch of salt. Ready in under 20 minutes with no special equipment needed.

Total time
15 min
Servings
12
Calories
186
Protein
4g
Pasteli (Sesame Brittle)
simplenostalgicgreekvegetarianvegandairy-freecrispycrunchy

Ingredients

  • 1 cup honey
  • 1.5 cups sesame seeds
  • ¼ teaspoon salt

Instructions

  1. 1

    Line a baking sheet with parchment paper, leaving a 1-inch border of paper exposed on all sides so you can grip it later.

  2. 2

    Pour the honey into a medium saucepan and place it over medium heat, stirring gently once every 30 seconds until the honey feels warm to the touch and moves easily, about 2–3 minutes.

  3. 3

    Pour the sesame seeds into the warm honey and stir constantly using a wooden spoon, scraping the bottom and sides, until every seed is coated and the mixture turns golden-brown like caramel, about 3–4 minutes.

  4. 4

    Remove the pan from heat and sprinkle in the salt, stirring once more to combine thoroughly.

  5. 5

    Pour the mixture onto the parchment paper in a single layer, spreading it gently with the back of a wooden spoon into an even sheet about 1/4-inch thick.

  6. 6

    Let the pasteli cool on the counter until it is completely hard and no longer sticky to the touch, about 8–10 minutes.

  7. 7

    Once cool, break the pasteli into roughly 2-inch irregular shards by hand or with a knife, working directly on the parchment paper.

  8. 8

    Transfer the shards to an airtight container where they will stay crispy for up to 1 week.

Tools you’ll need

  • baking sheet
  • parchment paper
  • medium saucepan
  • wooden spoon
  • airtight container

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.