CookSnap is coming soon — Join the waitlist →
Back to recipes

Pastel de Camarão

Crispy Brazilian shrimp pastels with a simple filling and golden exterior. Served warm with lime wedges, these hand-held golden pockets are a beloved street food that come together in under 30 minutes.

Total time
28 min
Servings
4
Calories
385
Protein
18g
Pastel de Camarão
casualindulgentbrazilianshrimpcrispytenderweeknightparty

Ingredients

  • 2 cups all-purpose flour
  • ¾ cup warm water
  • ½ teaspoon salt
  • 1 pound large shrimp, peeled and deveined
  • 2 whole green onions, chopped
  • 2 quarts vegetable oil for deep frying

Instructions

  1. 1

    Combine 2 cups flour, 0.75 cup warm water, and 0.5 teaspoon salt in a large bowl and stir with a wooden spoon until a smooth dough forms, about 2 minutes.

  2. 2

    Chop 1 pound shrimp into 1/4-inch pieces, about the size of peas, using a sharp chef's knife on a cutting board.

  3. 3

    Chop the 2 green onions crosswise into thin slices, about the thickness of a pencil, keeping white and green parts separate.

  4. 4

    Mix the chopped shrimp and green onion pieces together in a small bowl with a pinch of salt and black pepper until evenly combined.

  5. 5

    Dust a work surface lightly with flour, then divide the dough into 8 equal balls by pinching off chunks and rolling each between your palms until round and smooth.

  6. 6

    Place one dough ball on the floured surface, then use a rolling pin to flatten it into a thin circle about 4 inches across and the thickness of a credit card.

  7. 7

    Place 1 tablespoon of the shrimp mixture in the center of the circle, slightly below the middle, leaving a 0.5-inch border of empty dough all around.

  8. 8

    Fold the top half of the dough circle down over the filling, then use the tines of a fork to press and seal the edges together, creating a tight half-moon shape.

  9. 9

    Repeat steps 6–8 with the remaining 7 dough balls and shrimp filling until all pastels are assembled and sealed.

  10. 10

    Pour 2 quarts vegetable oil into a heavy-bottomed pot and heat over medium-high heat until the oil shimmers and a wooden spoon handle inserted into it produces tiny bubbles, about 5 minutes.

  11. 11

    Carefully place 2 pastels into the hot oil and fry until the surface turns golden brown, the color of honey, about 2 minutes.

  12. 12

    Flip the pastels gently with a slotted spoon and fry the second side until it also turns golden brown, about 2 more minutes.

  13. 13

    Use the slotted spoon to scoop the pastels onto a clean paper towel-lined plate to drain excess oil.

  14. 14

    Repeat steps 11–13 with the remaining 6 pastels, working in batches of 2 to avoid crowding the pot.

  15. 15

    Serve the pastels warm as soon as all are fried, with lime wedges on the side for squeezing.

Tools you’ll need

  • large mixing bowl
  • wooden spoon
  • small bowl
  • sharp chef's knife
  • cutting board
  • rolling pin
  • fork
  • heavy-bottomed pot (3-quart or larger)
  • wooden spoon or chopstick for testing oil temperature
  • slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.