CookSnap is coming soon — Join the waitlist →
Back to recipes

Pansotti con Salsa di Noci

Delicate crescent-shaped pasta pockets filled with ricotta and herbs, draped in a silky walnut sauce. A refined yet achievable Ligurian classic that looks restaurant-worthy but takes just 25 minutes.

Total time
25 min
Servings
2
Calories
620
Protein
18g
Pansotti con Salsa di Noci
elegantsimpleitalianvegetarianvegetariantendercreamysilky

Ingredients

  • 16 wrappers round wonton wrappers
  • ¾ cup ricotta cheese
  • 3 tablespoons fresh basil, finely chopped
  • ¾ cup walnuts, raw
  • 1 clove garlic clove
  • ½ cup heavy cream

Instructions

  1. 1

    Pulse the walnuts and garlic clove in a food processor until the walnuts are chopped into pieces smaller than a grain of rice — like wet breadcrumbs, about 45 seconds.

  2. 2

    Pour the heavy cream into the processor and pulse until the mixture looks like smooth peanut butter with no white cream streaks visible, about 20 seconds.

  3. 3

    Add 0.5 teaspoons salt and pulse once to combine, then transfer to a small bowl and set aside.

  4. 4

    Spoon the ricotta into a small bowl, then add the basil and 0.25 teaspoons salt and stir with a fork until the basil is evenly mixed throughout.

  5. 5

    Lay one wonton wrapper on the cutting board in front of you — it should look like a small square about 3 inches on each side.

  6. 6

    Place 1 teaspoon of ricotta filling in the center of the wrapper, keeping it in a small mound away from all four edges.

  7. 7

    Dip your finger in a small bowl of water and wipe the water along all four edges of the wrapper — this acts like glue.

  8. 8

    Fold the wrapper diagonally in half so the corners meet exactly, forming a triangle, then press the wet edges together firmly so they seal.

  9. 9

    Pick up the triangle and bring the two points at the base (the ends of the long edge) together and press them to each other — the triangle should now look like a crescent moon.

  10. 10

    Place the finished pansotto on a plate and repeat steps 5 through 9 with the remaining 15 wonton wrappers and filling.

  11. 11

    Fill a large pot three-quarters full with water and bring it to a rolling boil over high heat, about 8 minutes, then add 1 teaspoon salt.

  12. 12

    Slide all 16 pansotti into the boiling water — they will immediately sink, then float to the surface after about 2 minutes.

  13. 13

    Once they float, let them cook for exactly 1 more minute, then carefully lift them out with a slotted spoon into a colander.

  14. 14

    Divide the walnut sauce between two serving bowls — about 0.25 cup per bowl.

  15. 15

    Arrange 8 pansotti on top of the sauce in each bowl, placing them in a single layer across the surface.

  16. 16

    Grind black pepper over each bowl, then serve immediately while the pasta is hot.

Tools you’ll need

  • food processor
  • small bowl
  • fork
  • cutting board
  • small bowl of water
  • large pot
  • slotted spoon
  • colander
  • serving bowls
  • pepper grinder

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.