CookSnap is coming soon — Join the waitlist →

Paneer Butter Masala

Creamy tomato-based curry with tender paneer cheese, finished with butter and cream. A comforting vegetarian main that comes together in 30 minutes.

Total time
30 min
Servings
4
Calories
385
Protein
18g
Paneer Butter Masala
comfortindulgentindianvegetarianpaneercreamytenderweeknight

Ingredients

  • 14 oz paneer, cut into 1-inch cubes
  • 14 oz canned crushed tomatoes
  • 1 medium onion, diced
  • 3 cloves garlic, minced
  • 3 tbsp butter
  • ½ cup heavy cream
  • 1.5 tsp garam masala

Instructions

  1. 1

    Heat 2 tbsp butter in a large skillet over medium until melted and foamy, ~1 minute.

  2. 2

    Add diced onion and cook, stirring, until softened and translucent, ~5 minutes.

  3. 3

    Stir in minced garlic and cook until fragrant, ~45 seconds.

  4. 4

    Add crushed tomatoes and garam masala, stir to combine.

  5. 5

    Simmer uncovered for 8 minutes, stirring occasionally, until sauce thickens slightly.

  6. 6

    Stir in heavy cream and remaining 1 tbsp butter until combined.

  7. 7

    Gently fold in paneer cubes and simmer for 3 minutes until heated through.

  8. 8

    Season with salt and pepper to taste. Serve over rice or with naan.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.