CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Pan-Seared Landjäger with Mustard & Apple

Crispy German smoked sausage paired with quick-pickled apples and whole-grain mustard. Ready in 20 minutes—pure weeknight comfort.

Total time
20 min
Servings
4
Calories
385
Protein
18g
Pan-Seared Landjäger with Mustard & Apple
heartycasualgermanporkcrispytenderweeknightmain-dish

Ingredients

  • 8 pieces (about 12 oz) landjäger sausage (or similar German smoked sausage)
  • 1 medium apple (Granny Smith or Honeycrisp)
  • 3 tbsp white vinegar
  • 3 tbsp whole-grain mustard
  • ½ tsp caraway seeds (optional)
  • 4 slices dark rye bread or pumpernickel
  • 2 tbsp fresh dill or parsley, chopped

Instructions

  1. 1

    Slice the apple into thin wedges. Toss with vinegar, mustard, and caraway seeds in a small bowl.

  2. 2

    Score the landjäger skin lightly with a knife. Heat a skillet over medium-high heat, no oil needed.

  3. 3

    Sear the sausage 2–3 minutes per side until the skin crisps and the center is warm. Shake the pan occasionally.

  4. 4

    Toast the rye bread in the same skillet (or toaster) until edges are golden.

  5. 5

    Plate the sausage and toast. Spoon pickled apples and mustard over the top, then sprinkle with fresh dill.

Tools you’ll need

  • 12-inch skillet
  • small bowl
  • sharp knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.