CookSnap is coming soon — Join the waitlist →
Back to recipes

Onion Uttapam

Crispy-edged Indian savory pancakes topped with caramelized onions and fresh herbs. Made from a simple fermented rice-and-lentil batter, uttapam comes together in 25 minutes and delivers restaurant-quality results at home.

Total time
40 min
Servings
2
Calories
285
Protein
6g
Onion Uttapam
comfortwholesomeindianvegetarianvegetariancrispyfluffyweeknight

Ingredients

  • ¾ cup rice, uncooked
  • ¼ cup urad dal (split black gram), uncooked
  • 2 whole onions, medium
  • ½ inch piece ginger, fresh
  • 1 whole green chili, optional
  • 3 tablespoon fresh cilantro or parsley, chopped
  • ¾ teaspoon salt
  • 5 tablespoon vegetable oil

Instructions

  1. 1

    Measure 0.75 cup rice and 0.25 cup urad dal into a bowl and rinse both separately under cold running water until the water runs clear, stirring gently with your fingers to remove dust and debris.

  2. 2

    Soak the rinsed rice and urad dal together in a bowl covered with water by 2 inches for 4 hours, or overnight at room temperature — the longer soak gives a fluffier batter.

  3. 3

    Drain the soaked rice and dal completely in a colander, shaking gently to remove excess water.

  4. 4

    Pour the drained rice and dal into a blender with 0.75 cup water, a 0.5-inch piece of peeled ginger, and 1 green chili if using — blend on high speed for 6–8 minutes until smooth and slightly frothy, scraping the sides once halfway through.

  5. 5

    Transfer the batter to a bowl and stir in 0.75 teaspoon salt until evenly mixed — the batter should pour easily, like thick yogurt.

  6. 6

    Peel 2 onions and slice each one in half from root to tip, then place each half flat on the cutting board and slice crosswise into thin half-moons, about 1/8-inch thick.

  7. 7

    Chop 3 tablespoons of fresh cilantro or parsley into small pieces about the size of rice grains.

  8. 8

    Heat a 10-inch non-stick skillet or cast iron pan over medium heat and add 1 tablespoon of oil — wait 30 seconds until the oil flows freely when you tilt the pan.

  9. 9

    Pour 0.5 cup of the batter onto the center of the hot pan and use the back of a wet spoon to spread it outward in a circular motion, making a thin even disc about 7 inches wide and 0.25-inch thick.

  10. 10

    Scatter a handful of the sliced onions (about 3 tablespoons) evenly across the top of the batter, pressing gently so they stick to the wet surface.

  11. 11

    Sprinkle 1 tablespoon of chopped cilantro over the onions and let the uttapam cook without moving it for 3–4 minutes, until the bottom turns golden-brown and the edges pull away slightly from the pan.

  12. 12

    Drizzle 0.5 tablespoon of oil around the edges of the uttapam and slide a spatula underneath to loosen it, then flip it carefully onto the other side — the surface should be firm enough to hold together.

  13. 13

    Cook the flipped side for 2–3 minutes until the bottom is also golden-brown and the edges feel crisp when you touch them with a fork.

  14. 14

    Slide the uttapam onto a plate and repeat steps 9–13 with the remaining batter, using 1 tablespoon of oil for each new uttapam — you will make 3–4 total.

Tools you’ll need

  • rice-measuring cup
  • bowl for soaking
  • colander
  • blender
  • 10-inch non-stick skillet or cast iron pan
  • rubber or silicone spatula, non-metal preferred
  • wooden spoon for spreading

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.