CookSnap is coming soon — Join the waitlist →
Back to recipes

One-Pan Cheesy Beef Shells

Ground beef and medium pasta shells cook together in one skillet with tomato sauce and melt into creamy, melted cheese. Ready in under 25 minutes—comfort food with zero cleanup.

Total time
24 min
Servings
4
Calories
680
Protein
38g
One-Pan Cheesy Beef Shells
comfortamericanbeefcreamytenderweeknightpastadinner

Ingredients

  • 1 lb ground beef
  • 2 cups medium pasta shells
  • 15 oz tomato sauce
  • 1.5 cups water
  • 1.5 cups sharp cheddar cheese, shredded
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Brown ground beef in a 12-inch skillet over medium-high heat, breaking it up with a spoon, ~6 minutes.

  2. 2

    Drain excess fat from the skillet, leaving about 1 tablespoon behind.

  3. 3

    Add pasta shells, tomato sauce, and water. Stir to combine and bring to a simmer.

  4. 4

    Simmer uncovered, stirring occasionally, until pasta is tender and liquid mostly absorbed, ~10 minutes.

  5. 5

    Remove from heat. Add cheese and stir until melted and creamy, ~1 minute.

  6. 6

    Season with salt and pepper to taste. Serve hot.

Tools you’ll need

  • 12-inch skillet with lid or foil cover
  • wooden spoon
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.