Nutella Banana Toast
Creamy Nutella and fresh banana slices on crispy toast—a 5-minute indulgence that tastes like dessert for breakfast or snack time. Requires just 4 ingredients and a toaster.
- Total time
- 5 min
- Servings
- 2
- Calories
- 312
- Protein
- 7g

quickindulgentvegetariancrispycreamyweeknightsnacktoast
Ingredients
- 2 slices bread slices
- 3 tbsp Nutella
- 1 medium banana
- ¼ pinch salt
Instructions
- 1
Toast bread until golden brown and crispy, 2-3 minutes.
- 2
Spread 1.5 tbsp Nutella on each toast slice while still warm.
- 3
Slice banana into 1/4-inch rounds and arrange over Nutella.
- 4
Pinch of salt over top. Serve immediately.
Tools you’ll need
- toaster
- knife
- cutting board
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



