No-Bake Protein Energy Balls
Chewy, satisfying balls packed with oats, nut butter, and protein powder—ready in 10 minutes, no oven needed. Perfect grab-and-go snack or post-workout refuel.
- Total time
- 10 min
- Servings
- 12
- Calories
- 145
- Protein
- 7g

energizingvegetarianvegetarianchewydensesnackpost-workoutsnack
Ingredients
- 1 cup rolled oats
- ½ cup natural peanut or almond butter
- ⅓ cup vanilla protein powder
- 3 tbsp honey or maple syrup
- ¼ cup chocolate chips (semi-sweet or dark), optional
Instructions
- 1
Combine oats, nut butter, protein powder, and honey in a large bowl.
- 2
Stir until the mixture forms a thick, slightly wet dough. Add chocolate chips if using.
- 3
Scoop mixture into 1-inch balls (about 1 tbsp each) and place on a parchment-lined plate.
- 4
Refrigerate 20 minutes until firm, then store in an airtight container up to 1 week.
Tools you’ll need
- large mixing bowl
- spoon or spatula
- parchment paper
- plate
- airtight container
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



