CookSnap is coming soon — Join the waitlist →
Back to recipes

No-Bake Protein Energy Balls

Chewy, satisfying balls packed with oats, nut butter, and protein powder—ready in 10 minutes, no oven needed. Perfect grab-and-go snack or post-workout refuel.

Total time
10 min
Servings
12
Calories
145
Protein
7g
No-Bake Protein Energy Balls
energizingvegetarianvegetarianchewydensesnackpost-workoutsnack

Ingredients

  • 1 cup rolled oats
  • ½ cup natural peanut or almond butter
  • ⅓ cup vanilla protein powder
  • 3 tbsp honey or maple syrup
  • ¼ cup chocolate chips (semi-sweet or dark), optional

Instructions

  1. 1

    Combine oats, nut butter, protein powder, and honey in a large bowl.

  2. 2

    Stir until the mixture forms a thick, slightly wet dough. Add chocolate chips if using.

  3. 3

    Scoop mixture into 1-inch balls (about 1 tbsp each) and place on a parchment-lined plate.

  4. 4

    Refrigerate 20 minutes until firm, then store in an airtight container up to 1 week.

Tools you’ll need

  • large mixing bowl
  • spoon or spatula
  • parchment paper
  • plate
  • airtight container

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.