Custrd is out on the App Store — Download it free →
Back to recipes

Mushroom Noodle Bowl with Poached Egg

A comforting bowl of noodles tossed with savory mushrooms and garlic, topped with a perfectly poached egg and fresh herbs. Quick enough for a weeknight, yet satisfying enough for a cozy dinner.

Total time
30 min
Servings
2
Calories
450
Protein
20g
Mushroom Noodle Bowl with Poached Egg
comfortingfusionvegetarianeggchewytenderweeknightmain

Ingredients

  • 8 oz noodles
  • 8 oz mixed mushrooms
  • 3 cloves garlic
  • 2 large eggs
  • 2 tbsp soy sauce
  • 2 stalks green onions
  • ¼ cup cilantro
  • ½ tsp red pepper flakes

Instructions

  1. 1

    Bring a large pot of salted water to a boil. Add the 8 oz noodles and cook according to package directions until al dente, about 6-8 minutes. Reserve 1/2 cup of pasta water, then drain the noodles.

  2. 2

    While the noodles cook, slice the 8 oz mushrooms and mince the 3 garlic cloves. Thinly slice the 2 green onions and chop the 1/4 cup cilantro.

  3. 3

    Heat a large skillet over medium-high heat. Add the mushrooms and cook without stirring for 3-4 minutes until they start to brown. Add the garlic and cook for 1 minute until fragrant.

  4. 4

    Add the cooked noodles, 2 tbsp soy sauce, and 1/4 cup of the reserved pasta water to the skillet. Toss everything together for 2-3 minutes until the noodles are well coated and heated through. Season with salt and pepper to taste.

  5. 5

    Meanwhile, bring a small pot of water to a gentle simmer. Crack each of the 2 eggs into a small bowl, then slide them into the water. Poach for 3-4 minutes until the whites are set but the yolks are still runny.

  6. 6

    Divide the noodle mixture between two bowls. Top each with a poached egg, then sprinkle with the sliced green onions, chopped cilantro, and 1/2 tsp red pepper flakes. Serve immediately.

  7. 7

    For extra flavor, stir in a splash of rice vinegar or a drizzle of sesame oil along with the soy sauce.

Tools you’ll need

  • large pot
  • skillet
  • small pot
  • colander
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.