CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Mug Tiramisu

Individual tiramisu made in a mug—no baking required. Layers of coffee-soaked ladyfingers, creamy mascarpone, and cocoa powder are ready in minutes.

Total time
15 min
Servings
2
Calories
285
Protein
5g
Mug Tiramisu
indulgentsimpleitalianvegetariancreamyfluffysoftdessert

Ingredients

  • ½ cup strong brewed coffee, cooled
  • 6 oz mascarpone cheese
  • 3 tablespoon granulated sugar
  • ¼ teaspoon vanilla extract
  • 8 whole ladyfinger cookies (savoiardi)
  • 1 tablespoon unsweetened cocoa powder

Instructions

  1. 1

    Pour the cooled coffee into a shallow dish about the size of a cereal bowl.

  2. 2

    Place the mascarpone, sugar, and vanilla extract in a small bowl and whisk together until the mixture looks pale and fluffy, about 1 minute.

  3. 3

    Quickly dip one ladyfinger into the coffee dish for exactly 1 second on each side—it should feel soft but not falling apart—and place it in the bottom of the first mug.

  4. 4

    Repeat dipping and place a second soaked ladyfinger on top of the first one in the same mug.

  5. 5

    Spoon half of the mascarpone mixture on top of the ladyfingers in the first mug, spreading it gently into an even layer.

  6. 6

    Repeat steps 3–5 with the second mug using 2 more dipped ladyfingers and the remaining mascarpone mixture.

  7. 7

    Use a fine-mesh sieve or fine sifter to dust the top of each mug evenly with cocoa powder until you can no longer see the mascarpone layer beneath.

  8. 8

    Serve immediately, or cover and refrigerate for up to 4 hours before serving.

Tools you’ll need

  • 2 mugs (8–12 oz capacity)
  • shallow dish or saucer
  • small bowl
  • whisk
  • small spoon
  • fine-mesh sieve or fine sifter

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.