CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Moroccan Sardine Kefta

Pan-fried sardine patties spiced with cumin, paprika, and cilantro, inspired by traditional Moroccan kefta. Crispy outside, tender inside—ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
285
Protein
18g
Moroccan Sardine Kefta
rusticcasualmoroccanfishcrispytenderweeknightappetizer

Ingredients

  • 2 cans (3.75 oz each), drained canned sardines in oil
  • ¼ cup fresh cilantro, finely chopped
  • ½ medium onion, minced
  • 1 teaspoon ground cumin
  • ¾ teaspoon paprika
  • 2 cloves garlic, minced
  • ¼ cup breadcrumbs
  • 3 tablespoons olive oil

Instructions

  1. 1

    Place the drained sardines in a medium bowl, breaking them apart with a fork into flaked pieces the size of pea halves, about 1 minute of gentle pressing.

  2. 2

    Mince the onion into pieces smaller than a grain of rice—about pencil-tip dots—until you have roughly 3 tablespoons of onion.

  3. 3

    Mince the garlic until the pieces are smaller than a grain of rice, about the size of pencil-tip dots, yielding roughly 1 teaspoon.

  4. 4

    Finely chop the cilantro by slicing the leaves lengthwise into thin strips, then crossing those strips with perpendicular cuts until pieces are pencil-tip size.

  5. 5

    Add the minced onion, minced garlic, chopped cilantro, ground cumin, paprika, and breadcrumbs to the bowl with the flaked sardines.

  6. 6

    Mix gently with a fork, stirring in one direction until the ingredients are evenly distributed and the mixture holds together loosely, about 1 minute.

  7. 7

    Divide the mixture into 8 equal portions, then shape each portion between your palms into a small oval patty about the size of a golf ball, roughly 2 inches long and 0.75 inches thick.

  8. 8

    Heat 3 tablespoons of olive oil in a 10-inch nonstick skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  9. 9

    Carefully lay the 8 sardine patties in the hot oil in a single layer—they should sizzle loudly on contact.

  10. 10

    Cook without moving the patties for 3 to 4 minutes, until the undersides turn the color of warm honey with darker edges.

  11. 11

    Using a thin metal spatula, carefully flip each patty to the other side, working quickly so the oil stays hot.

  12. 12

    Cook the second side for 2 to 3 minutes until it also turns golden-honey colored with darker edges and feels slightly firm when pressed gently.

  13. 13

    Transfer the cooked patties to a clean plate lined with paper towels to drain excess oil, about 1 minute.

Tools you’ll need

  • medium mixing bowl
  • fork
  • cutting board
  • chef's knife
  • 10-inch nonstick skillet
  • thin metal spatula
  • paper towels
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.