CookSnap is coming soon — Join the waitlist →

Moroccan Maakouda Sandwich

Crispy pan-fried potato and herb fritters tucked into warm bread with tangy harissa mayo. A beloved Moroccan street food sandwich ready in under 25 minutes.

Total time
22 min
Servings
2
Calories
485
Protein
9g
Moroccan Maakouda Sandwich
casualcomfortmoroccanveganvegancrispycreamyweeknight

Ingredients

  • 1 lb potatoes, waxy (such as red or fingerling)
  • ½ cup fresh cilantro or parsley, chopped
  • 2 cloves garlic, minced
  • 2 tablespoons harissa paste
  • ¼ cup vegan mayonnaise
  • 2 pieces flatbread or pita (2 pieces)

Instructions

  1. 1

    Place potatoes in a large pot and cover with cold water by 2 inches. Bring to a boil over high heat, then reduce to medium and simmer until a fork slides through the largest potato with no resistance, about 12 minutes. Drain in a colander.

  2. 2

    Once cool enough to touch, peel the skin off each potato by rubbing gently under cool running water or with your fingers — the skin should slip away easily.

  3. 3

    Place peeled potatoes in a medium bowl and use a fork or potato masher to break them into pieces about the size of chickpeas — leave them chunky, not smooth.

  4. 4

    Add 0.5 teaspoon salt, 0.25 teaspoon pepper, the minced garlic, and the chopped cilantro to the bowl and stir gently until just combined.

  5. 5

    In a small bowl, whisk together the vegan mayonnaise and harissa paste until uniform and the color is a light orange-pink, about 20 seconds.

  6. 6

    Heat 2 tablespoons olive oil in a 12-inch nonstick skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 1 minute.

  7. 7

    Using a spoon or your damp hands, form the potato mixture into 8 oval patties, each about 2.5 inches long and 1 inch thick, and place them in the hot oil — you should hear a steady sizzle.

  8. 8

    Cook without moving for 3 minutes, until the bottom is golden brown and the edges are darker, about the color of peanut butter.

  9. 9

    Using a thin spatula, flip each patty over and cook the second side for 2 minutes, until golden and crispy, then transfer to a plate lined with paper towels.

  10. 10

    Warm the flatbread in the same skillet over medium heat for 30 seconds on each side — it should puff slightly and turn golden.

  11. 11

    Spread 1.5 tablespoons harissa mayo on the inside of each warm flatbread, then place 4 maakouda patties inside each one.

  12. 12

    Cut each sandwich diagonally in half and serve immediately while the maakouda are still warm and crispy.

Tools you’ll need

  • large pot
  • colander
  • fork or potato masher
  • medium bowl
  • small bowl
  • whisk
  • 12-inch nonstick skillet
  • spoon or damp hands
  • thin spatula
  • paper towels
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.