Custrd is out on the App Store — Download it free →
Back to recipes

Molletes

A quick and satisfying open-faced sandwich with refried beans, melted cheese, and your favorite toppings. Perfect for breakfast or a fast lunch.

Total time
15 min
Servings
2
Calories
520
Protein
28g
Molletes
comfortingquickMexicanhamcheesecrispymeltyweeknight

Ingredients

  • 2 bolillo rolls
  • 1 cup refried beans
  • 1 cup shredded cheese (like Monterey Jack or cheddar)
  • ½ cup salsa roja or tomato sauce
  • 4 oz sliced ham
  • ¼ cup sliced black olives

Instructions

  1. 1

    Preheat the broiler. Slice the 2 bolillo rolls in half lengthwise and place them cut-side up on a baking sheet. Broil until lightly toasted, about 2 minutes.

  2. 2

    Spread 1 cup refried beans evenly over the cut sides of the rolls. Top with 4 oz sliced ham and 1 cup shredded cheese.

  3. 3

    Broil until the cheese is melted and bubbly, about 3 minutes. Watch closely to avoid burning.

  4. 4

    Spoon 0.5 cup salsa roja over the top and sprinkle with 0.25 cup sliced black olives. Serve warm.

  5. 5

    Add any extra toppings like sautéed mushrooms or bell peppers if you like.

Tools you’ll need

  • baking sheet
  • broiler
  • knife
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.