CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Mini Grilled Cheese

Crispy, buttery bread with melted cheese in under 10 minutes. A classic snack scaled down and ready to eat.

Total time
8 min
Servings
2
Calories
280
Protein
9g
Mini Grilled Cheese
comfortquickamericanvegetariancrispymeltysnackweeknight

Ingredients

  • 4 slices bread (white, sourdough, or whole wheat)
  • 2 slices cheddar or American cheese
  • 1 tbsp butter, softened
  • 0 salt and pepper to taste

Instructions

  1. 1

    Butter one side of each bread slice generously. Season the buttered sides lightly with salt and pepper.

  2. 2

    Heat a skillet over medium heat. Once hot, place one slice butter-side down and top with one cheese slice.

  3. 3

    Cover with a second bread slice, butter-side up. Cook 2 to 3 minutes until the bottom is golden brown.

  4. 4

    Flip and cook the other side 1 to 2 minutes until golden and cheese is fully melted. Remove to a plate.

  5. 5

    Repeat with remaining bread and cheese to make the second sandwich.

  6. 6

    Cut each sandwich in half diagonally. Serve while hot.

Tools you’ll need

  • 8-inch or 10-inch skillet
  • butter knife
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.