CookSnap is coming soon — Join the waitlist →

Middle Eastern Chicken Shawarma Bowl

Spiced chicken thighs roasted with warm spices, served over rice with crisp vegetables and a garlicky yogurt drizzle. Ready in under 40 minutes.

Total time
35 min
Servings
4
Calories
520
Protein
38g
Middle Eastern Chicken Shawarma Bowl
satisfyingcozymiddle-easternchickentendercrispyweeknightdinner

Ingredients

  • 1.5 lbs chicken thighs, boneless and skinless
  • 3 tbsp olive oil
  • 2 tbsp warm spice blend (cumin, paprika, cinnamon, cloves, allspice)
  • 4 cloves garlic, minced
  • 1 whole lemon (juiced)
  • ½ cup greek yogurt
  • 1 set cooked rice, cucumber, tomato, onion, fresh herbs (parsley, cilantro)

Instructions

  1. 1

    Pat chicken dry. Mix spice blend, 2 tbsp olive oil, garlic, lemon juice, and salt.

  2. 2

    Toss chicken in spice mixture until coated. Let sit 10 minutes.

  3. 3

    Heat remaining 1 tbsp oil in a large skillet over medium-high until shimmering.

  4. 4

    Sear chicken 4 minutes per side without moving. Edges should look opaque and caramelized.

  5. 5

    Stir yogurt with 1 minced garlic clove and pinch of salt.

  6. 6

    Slice chicken into bite-sized pieces.

  7. 7

    Divide rice among bowls. Top with chicken, fresh cucumber, tomato, onion, and herbs.

  8. 8

    Drizzle garlic yogurt over the top. Serve warm.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • knife
  • small bowl
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.