Melty Pepper Jack Grilled Cheese
Crispy buttered bread with melted pepper jack cheese—sharp, slightly spicy, and ridiculously quick. Serve with a side salad to round it out.
- Total time
- 10 min
- Servings
- 1
- Calories
- 380
- Protein
- 14g
comfortquickamericanvegetariancrispymeltyweeknightlunch
Ingredients
- 2 slices bread
- 2 slices pepper jack cheese
- 1 tbsp butter
Instructions
- 1
Butter one side of each bread slice generously.
- 2
Heat a skillet over medium heat. Once hot, lay one slice butter-side down.
- 3
Layer pepper jack slices on top, then place the second bread slice butter-side up.
- 4
Cook until the bottom is golden brown and crispy, about 3 minutes.
- 5
Flip carefully and cook the other side until golden and the cheese is fully melted, 2–3 minutes.
- 6
Slide onto a plate. Serve hot with the side salad.
Tools you’ll need
- 8-inch or 10-inch nonstick or cast iron skillet
- spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
