CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Mediterranean Roasted Chicken Thighs

Bone-in chicken thighs roasted with olives, cherry tomatoes, and lemon until golden and juicy. Sheet-pan simplicity with bold Mediterranean flavors, ready in under 30 minutes.

Total time
28 min
Servings
2
Calories
412
Protein
38g
Mediterranean Roasted Chicken Thighs
simplefreshmediterraneanchickencrispyjuicytenderweeknight

Ingredients

  • 4 thighs bone-in, skin-on chicken thighs
  • 1.5 cups cherry tomatoes
  • ¾ cup kalamata olives, pitted
  • 1 whole lemon
  • 3 cloves garlic cloves, minced
  • 3 tablespoons olive oil

Instructions

  1. 1

    Set the oven to 425°F and wait until the indicator light or beep tells you it has finished heating, about 8–10 minutes.

  2. 2

    Pat the chicken thighs dry with paper towels by pressing gently all over the skin and underside until no visible moisture remains.

  3. 3

    Mince the garlic cloves until the pieces are smaller than a grain of rice — about the size of pencil-tip dots.

  4. 4

    Cut the lemon in half lengthwise from end to end, then slice each half crosswise into thin half-moon slices about 1/4 inch thick.

  5. 5

    Arrange the chicken thighs skin-side up on a sheet pan so they do not touch, leaving space around each thigh.

  6. 6

    Scatter the cherry tomatoes, olives, lemon slices, and minced garlic around the chicken in the empty spaces on the pan.

  7. 7

    Drizzle 3 tablespoons of olive oil evenly over the chicken thighs and vegetables, then sprinkle salt and pepper over everything.

  8. 8

    Slide the sheet pan into the hot oven and roast until the chicken skin is the color of warm honey with dark brown edges, about 18–20 minutes.

  9. 9

    Remove the sheet pan from the oven using oven mitts and transfer the chicken and vegetables to a serving plate.

Tools you’ll need

  • oven
  • sheet pan (18 × 13 inches or larger)
  • paper towels
  • knife
  • cutting board
  • oven mitts

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.