CookSnap is coming soon — Join the waitlist →
Back to recipes

Mediterranean Falafel Bowl

Crispy homemade falafel served over fluffy hummus with fresh vegetables, creamy tahini sauce, and tangy yogurt. A protein-packed vegetarian bowl that tastes like the Mediterranean.

Total time
45 min
Servings
2
Calories
520
Protein
18g
Mediterranean Falafel Bowl
freshwholesomemediterraneanvegetarianchickpeascrispycreamyfluffy

Ingredients

  • 1.5 cans (15 oz each) canned chickpeas, drained and patted dry
  • ¼ medium onion, roughly chopped
  • 2 cloves garlic cloves
  • ½ cup fresh parsley, loosely packed
  • 3 tablespoons all-purpose flour
  • 1 teaspoon ground cumin
  • ½ cup tahini
  • ½ cup plain Greek yogurt
  • 2 tablespoons lemon juice

Instructions

  1. 1

    Place the drained chickpeas, onion, garlic, and parsley in a food processor and pulse until the mixture looks like coarse wet sand with no large chunks remaining, about 15 pulses.

  2. 2

    Sprinkle the flour and cumin over the chickpea mixture and pulse 5 more times until just combined, so the mixture holds together when squeezed but is not smooth.

  3. 3

    Scoop the mixture into 12 equal balls, each about the size of a golf ball, and place them on a plate.

  4. 4

    Pour 1.5 inches of neutral oil into a medium saucepan and heat over medium-high heat until a falafel ball immediately sizzles and floats to the surface when you carefully drop it in, about 3–4 minutes.

  5. 5

    Carefully place 6 falafel balls into the oil and fry for 2–3 minutes, stirring gently with a slotted spoon, until they are deep golden brown on all sides.

  6. 6

    Use the slotted spoon to transfer the cooked falafel to a paper-towel-lined plate.

  7. 7

    Repeat steps 5–6 with the remaining 6 falafel balls, letting the oil return to temperature between batches, about 2–3 minutes.

  8. 8

    Whisk together the tahini, Greek yogurt, and 3 tablespoons of water until the mixture is smooth and pourable, like thick pancake batter.

  9. 9

    Stir in the lemon juice and a pinch of salt, then taste and adjust salt or lemon juice to your preference.

  10. 10

    Spread half of the tahini sauce onto each of two serving bowls in a thin, even layer covering the bottom.

  11. 11

    Arrange 6 warm falafel balls in a circle on top of the sauce in each bowl.

Tools you’ll need

  • food processor
  • medium saucepan
  • instant-read or candy thermometer (optional, for oil temperature)
  • slotted spoon
  • paper towels
  • whisk
  • two serving bowls
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.