Custrd is out on the App Store — Download it free →
Back to recipes

Mashed Potatoes with Bacon and Caramelized Onions

Creamy mashed potatoes topped with crispy bacon and sweet caramelized onions. A quick and comforting side dish that's ready in about 20 minutes.

Total time
20 min
Servings
4
Calories
320
Protein
9g
Mashed Potatoes with Bacon and Caramelized Onions
comfortingamericanporkcreamycrispyweeknightsideside dish

Ingredients

  • 1.5 lb potatoes
  • 4 slices bacon
  • 1 large onion
  • 2 tbsp butter
  • ¼ cup milk
  • ½ tsp salt

Instructions

  1. 1

    Peel and chop the 1.5 lb potatoes into 1-inch cubes. Place in a pot, cover with cold water, add a pinch of salt, and bring to a boil. Cook until fork-tender, about 15 minutes.

  2. 2

    While potatoes cook, chop the 4 bacon slices into small pieces and cook in a skillet over medium heat until crispy, about 6 minutes. Remove bacon with a slotted spoon, leaving the fat in the pan.

  3. 3

    Thinly slice the 1 large onion and add to the bacon fat. Cook over medium-low heat, stirring occasionally, until soft and golden brown, about 10 minutes. If the pan gets dry, add a splash of water.

  4. 4

    Drain the potatoes and return to the pot. Add the 2 tbsp butter, 0.25 cup milk, and 0.5 tsp salt. Mash until smooth and creamy.

  5. 5

    Serve the mashed potatoes topped with the crispy bacon and caramelized onions.

Tools you’ll need

  • pot
  • skillet
  • potato masher

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.