5-Min Margherita Flatbread
Toast a flatbread, spread it with marinara, tear fresh mozzarella on top, and finish with basil. Crispy-chewy, ready in 5 minutes — the weeknight pizza that doesn't need an oven.
- Total time
- 5 min
- Servings
- 2
- Calories
- 380
- Protein
- 14g
simplecasualitalianvegetariancrispymeltyweeknightpizza
Ingredients
- 2 pieces flatbread
- ½ cup marinara sauce
- 8 oz fresh mozzarella
- ¼ cup fresh basil
Instructions
- 1
Heat a skillet over medium-high until a drop of water sizzles instantly.
- 2
Toast each flatbread 90 seconds per side until the surface is lightly golden and edges crisp.
- 3
Spread 2 tbsp marinara on each flatbread, then tear fresh mozzarella over the top.
- 4
Return to the skillet for 60 seconds until the cheese starts to soften and melt.
- 5
Scatter fresh basil leaves over the cheese and serve immediately.
Tools you’ll need
- 12-inch skillet
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
