CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Malaysian Loh Mee

Silky egg noodles tossed in a savory-sweet gravy with shrimp, chicken, and mushrooms. This one-pan comfort dish comes together in under 30 minutes with an elegant taste that feels restaurant-made.

Total time
25 min
Servings
2
Calories
520
Protein
38g
Malaysian Loh Mee
comfortsatisfyingmalaysianshrimpchickensilkytenderweeknight

Ingredients

  • 8 oz egg noodles (fresh or dried)
  • 6 oz shrimp, peeled and deveined
  • 6 oz chicken breast, cut into thin bite-sized pieces
  • 4 oz mushrooms (button or oyster), sliced
  • 3 tbsp soy sauce
  • 1.5 cups chicken or seafood stock
  • 1.5 tbsp cornstarch mixed with 2 tablespoons water (slurry)

Instructions

  1. 1

    Place each mushroom cap on the cutting board and slice straight down into 1/4-inch-thick pieces, slicing through both cap and stem, like cutting bread.

  2. 2

    Pat the shrimp dry with paper towels so they will cook evenly and brown properly when they hit the hot pan.

  3. 3

    Bring a large pot of water to a boil over high heat until you see rolling bubbles breaking the surface constantly, about 10 minutes.

  4. 4

    Add the egg noodles to the boiling water and stir gently with a fork for 5 seconds to separate them, then cook for the time listed on the package until tender but still firm.

  5. 5

    Drain the noodles in a colander and set aside; do not rinse them, as the starch helps the sauce cling.

  6. 6

    Heat 1 tablespoon of oil in a 12-inch skillet over medium-high heat until it shimmers and moves quickly when you tilt the pan, about 90 seconds.

  7. 7

    Add the chicken pieces to the hot oil and cook, stirring once every 15 seconds, until the outside turns white and firm, about 3 to 4 minutes.

  8. 8

    Add the shrimp to the skillet and stir gently with the chicken for 90 seconds until the shrimp curl and turn pink on the outside.

  9. 9

    Add the sliced mushrooms and stir constantly for 2 minutes until they soften and release their liquid into the pan.

  10. 10

    Pour in the 1.5 cups of stock and 3 tablespoons of soy sauce, then stir and bring to a gentle simmer (small bubbles breaking the surface slowly) over medium-high heat, about 90 seconds.

  11. 11

    Pour the cornstarch slurry into the simmering liquid and stir constantly for 60 seconds until the sauce thickens to the consistency of cream—it should coat a spoon.

  12. 12

    Add the cooked noodles to the skillet and toss with two forks or tongs for 30 seconds until the noodles are evenly coated with the glossy sauce.

  13. 13

    Divide the loh mee between two bowls, making sure each bowl gets equal noodles, gravy, and protein pieces, and serve while hot.

Tools you’ll need

  • large pot
  • colander
  • 12-inch skillet
  • fork
  • wooden spoon or rubber spatula
  • two forks or kitchen tongs
  • small bowl (for cornstarch slurry)
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.