CookSnap is coming soon — Join the waitlist →

Leche Frita

Crispy fried milk custard squares dusted with cinnamon and sugar—a beloved Spanish dessert with a creamy inside and golden-brown exterior. Ready in under 25 minutes.

Total time
25 min
Servings
4
Calories
520
Protein
3g
Leche Frita
indulgentcomfortspanishvegetariancrispycreamydessertweekend

Ingredients

  • 2 cups whole milk
  • ½ cup sugar, divided
  • ½ cup cornstarch
  • 1 teaspoon cinnamon
  • 2 cups olive oil
  • ¼ teaspoon salt

Instructions

  1. 1

    Pour 2 cups of milk into a medium saucepan. Add 0.5 cup of sugar and 0.25 teaspoon of salt. Stir with a whisk until the sugar dissolves, about 1 minute.

  2. 2

    Pour 0.5 cup of cornstarch into a small bowl. Slowly add 0.5 cup of cold milk to the cornstarch, stirring with a whisk until no lumps remain—the mixture should look like smooth, thick cream.

  3. 3

    Place the saucepan over medium heat and bring the milk to a simmer, stirring often, until tiny bubbles form around the edges and steam rises from the surface, about 5 minutes.

  4. 4

    Slowly pour the cornstarch mixture into the hot milk while whisking constantly to prevent lumps. Keep whisking for 2 minutes until the mixture thickens and looks like pudding.

  5. 5

    Remove the saucepan from heat. Pour the custard onto a parchment-lined baking sheet, spreading it with a rubber spatula into an even layer about 0.5 inch thick. Let it cool for 15 minutes until it firms up.

  6. 6

    Once the custard has cooled and is firm to the touch, use a knife to cut it into 2-inch-by-2-inch squares. A bench scraper or thin spatula helps lift each square without breaking.

  7. 7

    Pour 2 cups of olive oil into a large skillet or deep saucepan. Heat over medium-high heat until the oil shimmers and a wooden spoon handle dipped in it shows tiny, rapid bubbles, about 3 minutes.

  8. 8

    Working carefully, slide 3 or 4 custard squares into the hot oil using a slotted spoon or thin spatula. Fry for 1 to 2 minutes on the first side until the surface turns golden brown and looks like caramel.

  9. 9

    Flip each square gently with a slotted spoon or spatula. Fry the other side for 1 to 2 minutes until it also turns golden brown. Transfer the fried squares to a plate lined with paper towels.

  10. 10

    Repeat with remaining custard squares, working in batches so the oil stays hot. You should have 8 to 10 golden squares total.

  11. 11

    Mix 1 teaspoon of cinnamon with 2 tablespoons of sugar in a small bowl, stirring with a spoon until well combined.

  12. 12

    Sprinkle the cinnamon-sugar mixture generously over all the warm fried custard squares while they are still hot—the sugar will stick to the crispy surface. Serve immediately.

Tools you’ll need

  • medium saucepan
  • small bowl
  • whisk
  • rubber spatula
  • parchment paper
  • baking sheet
  • knife or bench scraper
  • large skillet or deep saucepan
  • slotted spoon or thin spatula
  • paper towels
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.