CookSnap is coming soon — Join the waitlist →
Back to recipes

Lebanese Mushroom Hummus

Creamy hummus topped with sautéed mushrooms, garlic, and warm spiced oil. A Lebanese-inspired dip that works as an appetizer, mezze, or side.

Total time
15 min
Servings
6
Calories
215
Protein
8g
Lebanese Mushroom Hummus
freshsimplelebanesevegetarianveganchickpeascreamytender

Ingredients

  • 1.5 cans (15 oz each) canned chickpeas (drained and rinsed)
  • ¼ cup tahini
  • 3 tbsp lemon juice
  • 3 clove garlic cloves (minced)
  • 8 oz mushrooms (cremini or button, sliced)
  • 4 tbsp olive oil, divided
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Add chickpeas, tahini, lemon juice, 2 minced garlic cloves, 2 tbsp olive oil, and 2 tbsp cold water to a food processor.

  2. 2

    Pulse until smooth and creamy. Season with salt and pepper to taste.

  3. 3

    Transfer hummus to a shallow bowl and spread into an even layer.

  4. 4

    Heat 2 tbsp olive oil in a large skillet over medium-high heat until shimmering, ~90 seconds.

  5. 5

    Add sliced mushrooms. Cook without stirring for 3 minutes until edges curl and brown.

  6. 6

    Stir in remaining garlic clove and cook until fragrant, ~30 seconds.

  7. 7

    Season with salt and pepper. Spoon warm mushroom mixture over hummus and serve immediately.

Tools you’ll need

  • food processor
  • large skillet
  • shallow serving bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.