CookSnap is coming soon — Join the waitlist →
Back to recipes

Lebanese Balila Breakfast Bowl

Creamy slow-cooked chickpeas infused with garlic and cumin, finished with a runny egg and a drizzle of lemon oil. A warming, protein-packed Lebanese classic.

Total time
35 min
Servings
2
Calories
285
Protein
12g
Lebanese Balila Breakfast Bowl
wholesomecomfortmiddle-easternvegetarianchickpeascreamysoftweeknight

Ingredients

  • 1 can (15 oz) canned chickpeas, drained and rinsed
  • 3 cloves garlic, minced
  • ½ tsp cumin
  • 3 tbsp olive oil, divided
  • 1 pinch salt and pepper to taste
  • 2 large eggs
  • 1 whole lemon
  • 2 tbsp fresh parsley or sumac for garnish (optional)

Instructions

  1. 1

    Heat 2 tbsp olive oil in a medium pot over medium heat until shimmering, ~90 seconds.

  2. 2

    Add minced garlic and cumin. Stir until fragrant, about 30 seconds.

  3. 3

    Add drained chickpeas and 1/2 cup water. Stir to combine.

  4. 4

    Simmer uncovered over medium-low heat for 20 minutes, stirring occasionally, until chickpeas are creamy and broth thickens slightly.

  5. 5

    Season with salt and pepper to taste.

  6. 6

    Make two small wells in the chickpea mixture. Crack eggs into each well.

  7. 7

    Cover pot and cook over medium-low heat until whites set but yolks still jiggle, 4–5 minutes.

  8. 8

    Drizzle with remaining 1 tbsp olive oil. Squeeze fresh lemon juice over the top.

  9. 9

    Garnish with fresh parsley or sumac if desired. Serve hot with warm pita or flatbread.

Tools you’ll need

  • medium pot with lid
  • wooden spoon
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.