CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Lau Bo Beef & Greens

Vietnamese beef and spinach sautéed in a garlicky, umami-rich sauce with fish sauce and lime. A weeknight one-pan dinner that tastes like a restaurant dish in under 10 minutes.

Total time
12 min
Servings
2
Calories
285
Protein
32g
Lau Bo Beef & Greens
quickfreshvietnamesebeeftendercrispyweeknightmain-dish

Ingredients

  • 12 oz beef ribeye or sirloin steak
  • 4 cups fresh spinach or bok choy
  • 4 cloves garlic, minced
  • 2 tbsp fish sauce (nước mắm)
  • 1 tbsp soy sauce
  • ½ whole lime
  • 1 tbsp sesame oil
  • 1 whole shallot, sliced thin

Instructions

  1. 1

    Slice beef against the grain into thin strips, about 1/4-inch thick. Pat dry with a paper towel.

  2. 2

    Heat 1 tbsp olive oil in a large skillet over medium-high heat until it shimmers, about 90 seconds.

  3. 3

    Working in one batch, sear beef 60 seconds per side without stirring—edges should look caramelized. Transfer to a plate.

  4. 4

    Add remaining oil, then cook shallot and garlic until fragrant, 30 seconds. Stir constantly so garlic doesn't burn.

  5. 5

    Add spinach, fish sauce, and soy sauce. Toss until greens wilt, about 60 seconds. Greens will shrink noticeably.

  6. 6

    Return beef to the skillet. Drizzle with sesame oil and squeeze lime juice over top. Toss gently and serve.

Tools you’ll need

  • 12-inch skillet or wok
  • wooden spoon
  • paper towels
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.