Landjäger Plate with Tomatoes & Bread
A simple German charcuterie plate: sliced landjäger sausage, crusty bread roll, and fresh cherry tomatoes. Ready in 5 minutes — perfect for weeknight dinner or a casual lunch.
- Total time
- 5 min
- Servings
- 2
- Calories
- 385
- Protein
- 18g
casualsimplegermanporkcrispychewyweeknightmain-dish
Ingredients
- 4 pieces landjäger sausage
- 2 pieces crusty bread roll
- 1 cup cherry tomatoes
- 1 tbsp whole grain mustard
- 1 pinch salt and pepper
Instructions
- 1
Slice landjäger sausage diagonally into 1/4-inch pieces.
- 2
Halve or quarter cherry tomatoes, then toss with a pinch of salt and pepper.
- 3
Slice bread rolls in half horizontally; spread a thin layer of mustard on each.
- 4
Arrange landjäger slices, tomatoes, and bread on a plate. Serve immediately.
Tools you’ll need
- cutting board
- knife
- plate
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
