CookSnap is coming soon — Join the waitlist →

15-Min Laksa with Prawns & Rice Noodles

Rich coconut curry broth built on a shortcut laksa paste, studded with prawns and tender rice noodles. Aromatic, spicy, and on the table in under 15 minutes.

Total time
15 min
Servings
4
Calories
320
Protein
28g
15-Min Laksa with Prawns & Rice Noodles
comfortaromaticmalaysianshrimptendersilkyweeknightsoup

Ingredients

  • 3 tbsp laksa paste (red or curry-based)
  • 1 can (14 oz) coconut milk
  • 2 cups seafood or chicken stock
  • 1 lb large prawns, peeled and deveined
  • 8 oz fresh rice noodles (or dried, pre-soaked)
  • 1 whole lime (halved for juicing)

Instructions

  1. 1

    Heat a large pot over medium. Add laksa paste and stir constantly for 1 minute until fragrant.

  2. 2

    Pour in coconut milk and stock, stirring to combine. Bring to a simmer, then add prawns.

  3. 3

    Cook prawns 3–4 minutes until they turn pink and opaque throughout. Do not overcook.

  4. 4

    Add rice noodles and stir. If using fresh noodles, cook 2 minutes; dried, 3–4 minutes until tender.

  5. 5

    Squeeze lime juice into the pot. Taste and add salt or a pinch more lime as needed.

  6. 6

    Ladle into bowls. Serve immediately, drizzling any extra lime over top.

Tools you’ll need

  • large pot (6-quart or bigger)
  • wooden spoon
  • tongs
  • ladle
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.